SERMORELIN

Quantity

Certificate of Analysis

Lot 2606AF - 99.1% by HPLC

5 mg

Synthetic peptide, 29 residues, C-terminal amide. Reference material for in vitro laboratory research use only.

Compound	Sermorelin (GHRH 1–29 amide)
CAS	86168-78-7
Sequence (1-letter)	YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Molecular formula	C₁₄₉H₂₄₆N₄₄O₄₂S
Molecular weight	3357.9 g/mol
Net content	5 mg per vial (gross fill; actual content per lot COA)
Form	Lyophilized powder
Storage	−20 °C, sealed and desiccated; hygroscopic
Testing	Identity and purity verified by third-party HPLC analysis; a lot-specific Certificate of Analysis is provided with each order.

Research Use Only. Not a drug, supplement, or food. Not for human or veterinary use. Not intended to diagnose, treat, cure, or prevent any disease.

SERMORELIN Structure

CAS: #86168-78-7
Molecular Formula: C₁₄₉H₂₄₆N₄₄O₄₂S
Molecular Weight: 3357.9 g/mol
PubChem ID: 16132308

Our Process

STEP 1

Precision Lyophilization

Lyophilized and vialed in the United States. Materia Research is a distributor, not a manufacturer.

STEP 2

Verified Purity

Every lot is tested by an independent ISO/IEC 17025 accredited laboratory. Purity and content by HPLC; identity by retention-time concordance per USP .

STEP 3

Same-Day Fulfillment

Orders dispatched same-day from a
U.S. facility.

STEP 1

Precision Lyophilization

Lyophilized and vialed in the United States. Materia Research is a distributor, not a manufacturer.

STEP 2

Verified Purity

Every lot is tested by an independent ISO/IEC 17025 accredited laboratory. Purity and content by HPLC; identity by retention-time concordance per USP .

STEP 3

Same-Day Fulfillment

Orders dispatched same-day from a
U.S. facility.

Email us, our dedicated team is here to help

Reach out and get a response within minutes.

Frequently Asked Questions

Everything you need to know about our products and processes.

What's the actual amount in each vial?

Each vial contains exactly what’s shown on the label. For example, a 10mg vial has exactly 10mg of lyophilized peptide. Researchers can divide it into smaller portions but the total amount remains 10mg.

Are additional supplies needed?

Peptides are supplied as lyophilized powder. They do not come reconstituted, and any extra supplies must be sourced separately for research applications.

How long does a vial last?

In lyophilized powder form, peptides stay stable for up to 2 years. After reconstitution, it should be refrigerated and is generally stable for up to 2 months.

Does the product come with instructions?

Vials ship lyophilized with a lot-specific COA. No protocols, solvents, or supplies are included.

How should I store these products?

Lyophilized peptides should be stored away from heat and light. Once reconstituted, they must be refrigerated to maintain stability.